PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa11g011770.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family B3
Protein Properties Length: 436aa    MW: 49817 Da    PI: 9.7878
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa11g011770.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B364.71.4e-2021102998
                     HHHHTT-EE--HHH.HTT.---..--SEEEEEE.TTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
              B3   9 dvlksgrlvlpkkfaeeh.ggkkeesktltled.esgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                       +ks+ + +p kf+++h +  k+e+kt++l++ ++  +W+vk+      ++++lt+GWkeFv+a++L++gDfvvFk+++++ f  +v++f+
  Csa11g011770.1  21 PGFKSH-IKIPVKFFSKHiK-GKHEGKTVKLRSdSWQGTWKVKM------EGHTLTNGWKEFVEAHDLRVGDFVVFKHERDMLF--HVTAFE 102
                     567777.99*********64.456889****997999*******......6678***********************9998888..888876 PP

2B367.71.6e-21147241299
                     EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
              B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                     f++++++++l+++ l +p++fa+++g++k ++ +++l++e+g+sWe +++  k++ ++++ +GWk+ + +n+Lk+g+ ++Fkl ++  ++lv+ +
  Csa11g011770.1 147 FSQTVTASNLSRDFLGVPRDFARRYGLDKGRH-EVVLMNEEGKSWESEVKSYKSG-QVFIFGGWKSLCTENKLKVGEPFTFKLLHN-AERLVFLL 238
                     678899**********************9776.****************655555.555556********************9995.55579999 PP

                     E-S CS
              B3  97 frk 99 
                     +++
  Csa11g011770.1 239 CSR 241
                     987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.104.8E-258106IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.14E-239110IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.09812104IPR003340B3 DNA binding domain
CDDcd100174.84E-1814101No hitNo description
SMARTSM010191.1E-2315104IPR003340B3 DNA binding domain
PfamPF023623.8E-1524100IPR003340B3 DNA binding domain
SuperFamilySSF1019362.55E-21140240IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.6E-21141240IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086314.931146241IPR003340B3 DNA binding domain
CDDcd100177.57E-18146240No hitNo description
SMARTSM010193.5E-30147242IPR003340B3 DNA binding domain
PfamPF023624.1E-21147241IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.108.7E-4247300IPR015300DNA-binding pseudobarrel domain
SMARTSM010192.3E-6249326IPR003340B3 DNA binding domain
SuperFamilySSF1019363.14E-7249327IPR015300DNA-binding pseudobarrel domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 436 aa     Download sequence    Send to blast
MENPSSLFSP ENAHFFQPLL PGFKSHIKIP VKFFSKHIKG KHEGKTVKLR SDSWQGTWKV  60
KMEGHTLTNG WKEFVEAHDL RVGDFVVFKH ERDMLFHVTA FEPSCCEVQY AQSLSHNEIG  120
ESSRKEKEVE ENVKTESDLF SSDLTCFSQT VTASNLSRDF LGVPRDFARR YGLDKGRHEV  180
VLMNEEGKSW ESEVKSYKSG QVFIFGGWKS LCTENKLKVG EPFTFKLLHN AERLVFLLCS  240
RTEAGPNRFV KLTPTPNSLK LGKHHLSVSF MRVNMLDKPG KIILVDKDKV EWLMKLKANE  300
VGAGESLTLE LIRGGTSPLL KFVSKMDQSP PSEAEARPYK RARVQRWSQE SRRLKHDVRQ  360
KIAEVGEPSR RTRSCNKSTG DQGKLQHTQF CSILDHVPKV RQSIEETLTS IRLFRAKLET  420
KEQNLEALLH EIGNY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010432840.10.0PREDICTED: B3 domain-containing protein REM8-like isoform X2
SwissprotQ8H2D10.0REM8_ARATH; B3 domain-containing protein REM8
TrEMBLD7MB411e-171D7MB41_ARALL; Putative uncharacterized protein
TrEMBLR0GZI51e-171R0GZI5_9BRAS; Uncharacterized protein
STRINGAT4G31680.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM20422261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31680.10.0B3 family protein